PPP1R13L Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

PPP1R13L Polyclonal Antibody

Product Name PPP1R13L Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse
isotype IgG
application WB
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 589-828 of human PPP1R13L (NP_006654.2).
Sequence PPPAPSQSSPPEQPQSMEMRSVLRKAGSPRKARRARLNPLVLLLDAALTGELEVVQQAVKEMNDPSQPNEEGITALHNAICGANYSIVDFLITAGANVNSPDSHGWTPLHCAASCNDTVICMALVQHGAAIFATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDELSFREGESVTVLRRDGPEETDWWWAALHGQEGYVPRNYFGLFPRVKPQRSKV
Recommended Dilution WB
Calculated MW 89kDa
Observed MW 105kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples LO2,SW480,U-87MG
Cellular Location Cytoplasm,Nucleus
Purification Method Affinity purification
RRID AB_2758011