RFWD2 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

RFWD2 Polyclonal Antibody

Product Name RFWD2 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse, Rat
isotype IgG
application WB;IHC
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 582-731 of human RFWD2 (NP_071902.2).
Sequence YYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
Recommended Dilution WB
Calculated MW 14kDa/57kDa/77kDa/78kDa/80kDa
Observed MW 110kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples HepG2,MCF7,Mouse brain
Cellular Location Cytoplasm,Nucleus speckle
Purification Method Affinity purification
RRID AB_2758012