MEF2A Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

MEF2A Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-230843

Product Name MEF2A Polyclonal Antibody
Application WB;IHC;IF
Application Key Western blotting
Calculated Mw 45kDa/46kDa/53kDa/54kDa
Cellular Location Nucleus
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEF2A (NP_001124400.1).
Isotype IgG
Observed Mw 55kDa
Product Background The protein encoded by this gene is a DNA-binding transcription factor that activates many muscle-specific, growth factor-induced, and stress-induced genes. The encoded protein can act as a homodimer or as a heterodimer and is involved in several cellular processes, including muscle development, neuronal differentiation, cell growth control, and apoptosis. Defects in this gene could be a cause of autosomal dominant coronary artery disease 1 with myocardial infarction (ADCAD1). Several transcript variants encoding different isoforms have been found for this gene.
Positive Samples U-87MG,HeLa,Rat testis,Rat brain
Purification Method Affinity purification
Recommended Dilution WB
Sequence MGRKKIQITRIMDERNRQTLRKKGLNGCESPDADDYFEHSPLSEDRFSKLNEDSDFIFKRGPPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAA
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.