PKLR Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

PKLR Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-230860

Product Name PKLR Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 58kDa/61kDa
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 446-556 of human PKLR (NP_000289.1).
Isotype IgG
Observed Mw 62kDa
Product Background The protein encoded by this gene is a pyruvate kinase that catalyzes the transphosphorylation of phohsphoenolpyruvate into pyruvate and ATP, which is the rate-limiting step of glycolysis. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA). Multiple transcript variants encoding different isoforms have been found for this gene.
Positive Samples BxPC-3,HepG2,293T,Mouse kidney,Mouse liver,Mouse heart,Rat kidney
Purification Method Affinity purification
Recommended Dilution WB
Sequence PLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVT
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.