PKLR Polyclonal Antibody
The product is for non-human research only. Not for therapeutic or veterinary use.
Catalog No: bt-230860
| Product Name | PKLR Polyclonal Antibody |
|---|---|
| Application | WB |
| Application Key | Western blotting |
| Calculated Mw | 58kDa/61kDa |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 446-556 of human PKLR (NP_000289.1). |
| Isotype | IgG |
| Observed Mw | 62kDa |
| Product Background | The protein encoded by this gene is a pyruvate kinase that catalyzes the transphosphorylation of phohsphoenolpyruvate into pyruvate and ATP, which is the rate-limiting step of glycolysis. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA). Multiple transcript variants encoding different isoforms have been found for this gene. |
| Positive Samples | BxPC-3,HepG2,293T,Mouse kidney,Mouse liver,Mouse heart,Rat kidney |
| Purification Method | Affinity purification |
| Recommended Dilution | WB |
| Sequence | PLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVT |
| Species Reactivity | Human, Mouse, Rat |
| Storage Buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |