TGFA Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

TGFA Polyclonal Antibody

Product Name TGFA Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human
isotype IgG
application WB
Product Background This gene encodes a growth factor that is a ligand for the epidermal growth factor receptor, which activates a signaling pathway for cell proliferation, differentiation and development. This protein may act as either a transmembrane-bound ligand or a soluble ligand. This gene has been associated with many types of cancers, and it may also be involved in some cases of cleft lip/palate. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-98 of human TGFA (NP_001093161.1).
Sequence ENSTSPLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQA
Recommended Dilution WB
Calculated MW 16kDa/17kDa
Observed MW Refer to figures
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Cellular Location Cell membrane,Secreted,Single-pass type I membrane protein,extracellular space
Purification Method Affinity purification
RRID AB_2759356