ARL10 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

ARL10 Polyclonal Antibody

Product Name ARL10 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human
isotype IgG
application WB
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-110 of human ARL10 (NP_001304877.1).
Sequence TYFGRGRERRWDRGEAWWGAEAARLPEWDEWDPEDEEDEEPALEELEQREVLVLGLDGAGKSTFLRVLSGKPPLEGHIPTW
Recommended Dilution WB
Calculated MW 27kDa
Observed MW 27kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples SH-SY5Y,293T
Purification Method Affinity purification
RRID AB_2759639