P Glycoprotein Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

P Glycoprotein Polyclonal Antibody

Product Name P Glycoprotein Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse, Rat
isotype IgG
application WB;IF
Product Background The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is an ATP-dependent drug efflux pump for xenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier. Mutations in this gene are associated with colchicine resistance and Inflammatory bowel disease 13. Alternative splicing and the use of alternative promoters results in multiple transcript variants.
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 630-710 of human P Glycoprotein (NP_000918.2).
Sequence TAGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPY
Recommended Dilution WB
Calculated MW 134kDa/141kDa
Observed MW 175kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples LO2,Mouse lung
Cellular Location Cell membrane,Multi-pass membrane protein
Purification Method Affinity purification
RRID AB_2759680