SLC7A9 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

SLC7A9 Polyclonal Antibody

Product Name SLC7A9 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse
isotype IgG
application WB
Product Background This gene encodes a protein that belongs to a family of light subunits of amino acid transporters. This protein plays a role in the high-affinity and sodium-independent transport of cystine and neutral and dibasic amino acids, and appears to function in the reabsorption of cystine in the kidney tubule. Mutations in this gene cause non-type I cystinuria, a disease that leads to cystine stones in the urinary system due to impaired transport of cystine and dibasic amino acids. Alternate transcript variants, which encode the same protein, have been found for this gene.
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC7A9 (NP_055085.1).
Sequence MGDTGLRKRREDEKSIQSQEPKTTSLQKELGLISGISIIVGTIIGSGIFVSPKSVLSNTEAVGPCLIIWAACGVLATLGALCFAELGTMITKSGGEYPYL
Recommended Dilution WB
Calculated MW 53kDa
Observed MW 53kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples LO2,Mouse kidney
Cellular Location Apical cell membrane,Multi-pass membrane protein
Purification Method Affinity purification
RRID AB_2759689