SPOCK3 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

SPOCK3 Polyclonal Antibody

Product Name SPOCK3 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse, Rat
isotype IgG
application WB
Product Background This gene encodes a member of a novel family of calcium-binding proteoglycan proteins that contain thyroglobulin type-1 and Kazal-like domains. The encoded protein and may play a role in adult T-cell leukemia by inhibiting the activity of membrane-type matrix metalloproteinases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 180-380 of human SPOCK3 (NP_001035249.1).
Sequence CPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKTLLRPERSRFDTSILPICKDSLGWMFNRLDTNYDLLLDQSELRSIYLDKNEQCTKAFFNSCDTYKDSLISNNEWCYCFQRQQDPPCQTELSNIQKRQGVKKLLGQYIPLCDEDGYYKPTQCHGSVGQCWCVDRYGNEVMGSRINGVADCAID
Recommended Dilution WB
Calculated MW 35kDa/36kDa/38kDa/44kDa/49kDa
Observed MW 49kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples Mouse brain,Rat brain
Cellular Location Secreted,extracellular matrix,extracellular space
Purification Method Affinity purification
RRID AB_2759690