SYT13 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

SYT13 Polyclonal Antibody

Product Name SYT13 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse
isotype IgG
application WB
Product Background This gene encodes a member of the large synaptotagmin protein family. Family members have an extracellular N-terminal transmembrane domain and a cytoplasmic C terminus with two tandem C2 domains (C2A and C2B). Synaptotogmin family members can form homo- and heteromeric complexes with each other. They also have different biochemical properties and developmental profiles, and patterns of tissue distribution. Synaptotagmins function as membrane traffickers in multicellular organisms. Two alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-180 of human SYT13 (NP_065877.1).
Sequence CRHMHPKKGLLPRDQDPDLEKAKPSLLGSAQQFNVKKSTEPVQPRALLKFPDIYGPRPAVTAPEVINYADYSLRSTEEPTAPASPQPPNDSRLKRQVTEELFILPQNGVVEDVCVMETWNPEKAASWNQAPKLHYCLDYDCQKAELFVTRL
Recommended Dilution WB
Calculated MW 46kDa
Observed MW 47kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples U-87MG,Mouse brain,Mouse heart
Cellular Location Membrane,Single-pass membrane protein
Purification Method Affinity purification
RRID AB_2759694