TLX1 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

TLX1 Polyclonal Antibody

Product Name TLX1 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse, Rat
isotype IgG
application WB
Product Background This gene encodes a nuclear transcription factor that belongs to the NK-linked or NK-like (NKL) subfamily of homeobox genes. The encoded protein is required for normal development of the spleen during embryogenesis. This protein is also involved in specification of neuronal cell fates. Ectopic expression of this gene due to chromosomal translocations is associated with certain T-cell acute lymphoblastic leukemias. Alternate splicing results in multiple transcript variants.
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human TLX1 (NP_001182446.1).
Sequence MEHLGPHHLHPGHAEPISFGIDQILNSPDQGGCMGPASRLQDGEYGLGCLVGGAYTYGGGGSAAATGAGGAGAYGTGGPGGPGGPAGGGGACSMGPLTGSYNVNMALAGGPGPGGGGGSSGGAGALSAAGVIRVPAHRPLAGAVAHPQPLATGLPTVPSVPAMPGVNNLTGLTFPWMESNRRYTKDRFTG
Recommended Dilution WB
Calculated MW 26kDa/34kDa
Observed MW 40kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples Jurkat,K562,Mouse spleen,Rat spleen
Cellular Location Nucleus
Purification Method Affinity purification
RRID AB_2759702