FTMT Polyclonal Antibody
Product Name | FTMT Polyclonal Antibody |
---|---|
Product Type | |
Host Species | Rabbit |
Species Reactivity | Mouse |
isotype | IgG |
application | WB |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 183-242 of human FTMT (NP_803431.1). |
Sequence | DKGDPHLCDFLETYYLNEQVKSIKELGDHVHNLVKMGAPDAGLAEYLFDTHTLGNENKQN |
Recommended Dilution | WB |
Calculated MW | 27kDa |
Observed MW | 21kDa, 28kDa |
Storage Buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application Key | Western blotting |
Positive Samples | Mouse testis |
Cellular Location | Mitochondrion |
Purification Method | Affinity purification |
RRID | AB_2759708 |