FTMT Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

FTMT Polyclonal Antibody

Product Name FTMT Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Mouse
isotype IgG
application WB
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 183-242 of human FTMT (NP_803431.1).
Sequence DKGDPHLCDFLETYYLNEQVKSIKELGDHVHNLVKMGAPDAGLAEYLFDTHTLGNENKQN
Recommended Dilution WB
Calculated MW 27kDa
Observed MW 21kDa, 28kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples Mouse testis
Cellular Location Mitochondrion
Purification Method Affinity purification
RRID AB_2759708