PTGDR Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

PTGDR Polyclonal Antibody

Product Name PTGDR Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Mouse
isotype IgG
application WB
Product Background This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor (GPCR) superfamily. The receptors are seven-pass transmembrane proteins that respond to extracellular cues and activate intracellular signal transduction pathways. This protein is reported to be a receptor for prostaglandin D2, which is a mediator of allergic inflammation and allergic airway inflammation in asthma. Alternative splicing results in multiple transcript variants.
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 220-359 of human PTGDR (NP_000944.1).
Sequence GAMRNLYAMHRRLQRHPRSCTRDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTSEEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL
Recommended Dilution WB
Calculated MW 32kDa/40kDa
Observed MW 43kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples NIH/3T3
Cellular Location Cell membrane,Multi-pass membrane protein
Purification Method Affinity purification
RRID AB_2759719