WSB2 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

WSB2 Polyclonal Antibody

Formulation:

Source:

Product Name WSB2 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Mouse, Rat
isotype IgG
application WB
Product Background This gene encodes a member of the WD-protein subfamily. The encoded protein contains five WD-repeats spanning most of the protein and an SOCS box in the C-terminus. The SOCS box may act as a bridge between specific substrate-binding domains and E3 ubiquitin protein ligases. Three transcript variants encoding different isoforms have been found for this gene.
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human WSB2 (NP_061109.1).
Sequence MEAGEEPLLLAELKPGRPHQFDWKSSCETWSVAFSPDGSWFAWSQGHCIVKLIPWPLEEQFIPKGFEAKSRSSKNETKGRGSPKEKTLDCGQIVWGLAFSPWPSPPSRKLWARHHPQVPDVSCLVLATGLNDGQIKIWEVQTGLLLLNLSGHQDVVRDLSFTPSGSLILVSASRDKTLRIWDLNKHGKQIQVLSGHLQWV
Recommended Dilution WB
Calculated MW 21kDa/45kDa/47kDa
Observed MW 40-43kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples Mouse kidney,Rat kidney,Rat spleen
Purification Method Affinity purification
RRID AB_2759818