RBM26 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

RBM26 Polyclonal Antibody

Product Name RBM26 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Mouse, Rat
isotype IgG
application WB
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 65-140 of human RBM26 (NP_071401.3).
Sequence TQIFVEKLFDAVNTKSYLPPPEQPSSGSLKVEFFPHQEKDIKKEEITKEEEREKKFSRRLNHSPPQSSSRYRENRS
Recommended Dilution WB
Calculated MW 13kDa/60kDa/62kDa/110kDa/111kDa/113kDa
Observed MW 113kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples Mouse brain,Mouse testis,Rat liver
Purification Method Affinity purification
RRID AB_2759969