PAPD4 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

PAPD4 Polyclonal Antibody

Product Name PAPD4 Polyclonal Antibody
Product Type
Host Species Rabbit
Species Reactivity Human, Mouse, Rat
isotype IgG
application WB
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human PAPD4 (NP_776158.2).
Sequence MFPNSILGRPPFTPNHQQHNNFFTLSPTVYSHQQLIDAQFNFQNADLSRAVSLQQLTYGNVSPIQTSASPLFRGRKRLSDEKNLPLDGKRQRFHSPHQEPTVVNQIVPLSGERRYSMPPLFHTHYVPDIVRCVPPFREIAFLEPREITLPEAKDKLSQQILELFETCQQQISDLKKKELCRTQLQREIQLLFPQSRLFLVGSSLNGFGTRSSDGDLCLVVKEEPCFFQVNQKTEARHILTLVHKHFCTRLSGYIERPQLIRAKVPIVKFRDKVSCVEFDLNVNNIVGIRNTFLLRTYAYL
Recommended Dilution WB
Calculated MW 55kDa/56kDa
Observed MW 54kDa
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key Western blotting
Positive Samples U-87MG,BxPC-3,Mouse heart,Rat heart
Cellular Location Cytoplasm,Nucleus
Purification Method Affinity purification
RRID AB_2760091