RBSN Polyclonal Antibody
The product is for non-human research only. Not for therapeutic or veterinary use.
Catalog No: bt-232398
| Product Name | RBSN Polyclonal Antibody |
|---|---|
| Application | WB |
| Application Key | Western blotting |
| Calculated Mw | 23kDa/88kDa |
| Cellular Location | Cell membrane,Cytoplasmic side,Early endosome membrane,Lipid-anchor |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human RBSN (NP_071735.2). |
| Isotype | IgG |
| Observed Mw | Refer to figures |
| Product Background | This gene encodes a protein that belongs to the FYVE zinc finger family of proteins. The encoded protein interacts with Ras-related proteins that regulate membrane trafficking. A missense mutation in this gene is associated with a defect in the early endocytic pathway. Alternative splicing results in multiple transcript variants. |
| Purification Method | Affinity purification |
| Recommended Dilution | WB |
| Sequence | MASLDDPGEVREGFLCPLCLKDLQSFYQLHSHYEEEHSGEDRDVKGQIKSLVQKAKKAKDRLLKREGDDRAESGTQGYESFSYGGVDPYMWEPQELGAVRSHLSDFKKHRAARIDHYVVEVNKLIIRLEKLTAFDRTNTESAKIRAIEKSVVPWVNDQDVPFCPDCGNKFSIRNRRHHCRLCGSIMCKKCMELISLPLAN |
| Species Reactivity | Mouse |
| Storage Buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |