RBSN Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

RBSN Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-232398

Product Name RBSN Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 23kDa/88kDa
Cellular Location Cell membrane,Cytoplasmic side,Early endosome membrane,Lipid-anchor
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human RBSN (NP_071735.2).
Isotype IgG
Observed Mw Refer to figures
Product Background This gene encodes a protein that belongs to the FYVE zinc finger family of proteins. The encoded protein interacts with Ras-related proteins that regulate membrane trafficking. A missense mutation in this gene is associated with a defect in the early endocytic pathway. Alternative splicing results in multiple transcript variants.
Purification Method Affinity purification
Recommended Dilution WB
Sequence MASLDDPGEVREGFLCPLCLKDLQSFYQLHSHYEEEHSGEDRDVKGQIKSLVQKAKKAKDRLLKREGDDRAESGTQGYESFSYGGVDPYMWEPQELGAVRSHLSDFKKHRAARIDHYVVEVNKLIIRLEKLTAFDRTNTESAKIRAIEKSVVPWVNDQDVPFCPDCGNKFSIRNRRHHCRLCGSIMCKKCMELISLPLAN
Species Reactivity Mouse
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.