NCOA7 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

NCOA7 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-232404

Product Name NCOA7 Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 12kDa/25kDa/28kDa/33kDa/92kDa/104kDa/106kDa
Cellular Location Nucleus
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human NCOA7 (NP_861447.3).
Isotype IgG
Observed Mw 130kDa
Positive Samples U-87MG,MCF7,OVCAR3,HeLa,DU145,Mouse brain,Rat brain
Purification Method Affinity purification
Recommended Dilution WB
Sequence MDTKEEKKERKQSYFARLKKKKQAKQNAETASAVATRTHTGKEDNNTVVLEPDKCNIAVEEEYMTDEKKKRKSNQLKEIRRTELKRYYSI
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.