GRIK4 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

GRIK4 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-232405

Product Name GRIK4 Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 107kDa
Cellular Location Cell junction,Cell membrane,Multi-pass membrane protein,postsynaptic cell membrane,synapse
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 21-220 of human GRIK4 (NP_055434.2).
Isotype IgG
Observed Mw 100kDa
Product Background This gene encodes a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. The protein encoded by this gene forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Positive Samples SH-SY5Y,Mouse brain,Mouse kidney,Rat brain,Rat kidney
Purification Method Affinity purification
Recommended Dilution WB
Sequence SPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLGKAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFKVAPEEFVKFQFQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLICAKAECLLNLEKLLRQFLISKDTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHAN
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.