CDHR5 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

CDHR5 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-232450

Product Name CDHR5 Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 69kDa/87kDa/88kDa
Cellular Location Cell membrane,Single-pass type I membrane protein
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 26-220 of human CDHR5 (NP_112554.2).
Isotype IgG
Observed Mw 88kDa
Product Background This gene is a novel mucin-like gene that is a member of the cadherin superfamily. While encoding nonpolymorphic tandem repeats rich in proline, serine and threonine similar to mucin proteins, the gene also contains sequence encoding calcium-binding motifs found in all cadherins. The role of the hybrid extracellular region and the specific function of this protein have not yet been determined. Alternatively spliced transcript variants encoding different isoforms have been described.
Positive Samples Mouse kidney,Rat kidney
Purification Method Affinity purification
Recommended Dilution WB
Sequence QAQYCSVNKDIFEVEENTNVTEPLVDIHVPEGQEVTLGALSTPFAFRIQGNQLFLNVTPDYEEKSLLEAQLLCQSGGTLVTQLRVFVSVLDVNDNAPEFPFKTKEIRVEEDTKVNSTVIPETQLQAEDRDKDDILFYTLQEMTAGASDYFSLVSVNRPALRLDRPLDFYERPNMTFWLLVRDTPGENVEPSHTAT
Species Reactivity Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.