ADCYAP1R1 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

ADCYAP1R1 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-232457

Product Name ADCYAP1R1 Polyclonal Antibody
Application WB;IF
Application Key Western blotting
Calculated Mw 46kDa/51kDa/53kDa/54kDa/56kDa
Cellular Location Cell membrane,Multi-pass membrane protein
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 21-155 of human ADCYAP1R1 (NP_001186564.1).
Isotype IgG
Observed Mw Refer to figures
Product Background This gene encodes type I adenylate cyclase activating polypeptide receptor, which is a membrane-associated protein and shares significant homology with members of the glucagon/secretin receptor family. This receptor mediates diverse biological actions of adenylate cyclase activating polypeptide 1 and is positively coupled to adenylate cyclase. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified.
Purification Method Affinity purification
Recommended Dilution WB
Sequence MHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTEDGWSEPFPHYFDACGFDEYESETGDQDYYYLSVKA
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.