SLC5A6 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

SLC5A6 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-232503

Product Name SLC5A6 Polyclonal Antibody
Application IF
Application Key Immunofluorescence
Calculated Mw 68kDa
Cellular Location Membrane,Multi-pass membrane protein
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 546-635 of human SLC5A6 (NP_066918.2).
Isotype IgG
Purification Method Affinity purification
Recommended Dilution IF
Sequence SLLTGRMRGRSLNPATIYPVLPKLLSLLPLSCQKRLHCRSYGQDHLDTGLFPEKPRNGVLGDSRDKEAMALDGTAYQGSSSTCILQETSL
Species Reactivity Human
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.