PLAUR Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

PLAUR Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-232563

Product Name PLAUR Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 31kDa/32kDa/36kDa
Cellular Location Cell membrane,Cell projection,GPI-anchor,Lipid-anchor,Secreted,invadopodium membrane
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-305 of human PLAUR (NP_002650.1).
Isotype IgG
Observed Mw 36-72kDa
Product Background This gene encodes the receptor for urokinase plasminogen activator and, given its role in localizing and promoting plasmin formation, likely influences many normal and pathological processes related to cell-surface plasminogen activation and localized degradation of the extracellular matrix. It binds both the proprotein and mature forms of urokinase plasminogen activator and permits the activation of the receptor-bound pro-enzyme by plasmin. The protein lacks transmembrane or cytoplasmic domains and may be anchored to the plasma membrane by a glycosyl-phosphatidylinositol (GPI) moiety following cleavage of the nascent polypeptide near its carboxy-terminus. However, a soluble protein is also produced in some cell types. Alternative splicing results in multiple transcript variants encoding different isoforms. The proprotein experiences several post-translational cleavage reactions that have not yet been fully defined.
Positive Samples DU145,HT-1080,A-549,HeLa,Mouse lung
Purification Method Affinity purification
Recommended Dilution WB
Sequence LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSG
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.