DBH Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

DBH Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-232564

Product Name DBH Polyclonal Antibody
Application WB;IHC;IF
Application Key Western blotting
Calculated Mw 69kDa
Cellular Location Cytoplasmic vesicle,Single-pass type II membrane protein,chromaffin granule lumen,chromaffin granule membrane,secretory vesicle,secretory vesicle lumen,secretory vesicle membrane
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 388-617 of human DBH (NP_000778.3).
Isotype IgG
Observed Mw Refer to figures
Product Background The protein encoded by this gene is an oxidoreductase belonging to the copper type II, ascorbate-dependent monooxygenase family. It is present in the synaptic vesicles of postganglionic sympathetic neurons and converts dopamine to norepinephrine. It exists in both soluble and membrane-bound forms, depending on the absence or presence, respectively, of a signal peptide.
Purification Method Affinity purification
Recommended Dilution WB
Sequence GYCTDKCTQLALPPSGIHIFASQLHTHLTGRKVVTVLVRDGREWEIVNQDNHYSPHFQEIRMLKKVVSVHPGDVLITSCTYNTEDRELATVGGFGILEEMCVNYVHYYPQTQLELCKSAVDAGFLQKYFHLINRFNNEDVCTCPQASVSQQFTSVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVISTLEEPTPQCPTSQGRSPAGPTVVSIGGGKG
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.