AGPAT3 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

AGPAT3 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-232995

Product Name AGPAT3 Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 36kDa/43kDa/45kDa
Cellular Location Endoplasmic reticulum membrane,Multi-pass membrane protein,Nucleus envelope
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 145-310 of human AGPAT3 (NP_064517.1).
Isotype IgG
Observed Mw 43kDa
Product Background The protein encoded by this gene is an acyltransferase that converts lysophosphatidic acid into phosphatidic acid, which is the second step in the de novo phospholipid biosynthetic pathway. The encoded protein may be an integral membrane protein. Two transcript variants encoding the same protein have been found for this gene.
Positive Samples 293T,A-549,LO2,U-87MG,Mouse kidney
Purification Method Affinity purification
Recommended Dilution WB
Sequence KRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAAKGLPVLKYHLLPRTKGFTTAVKCLRGTVAAVYDVTLNFRGNKNPSLLGILYGKKYEADMCVRRFPLEDIPLDEKEAAQWLHKLYQEKDALQEIYNQKGMFPGEQFKPARRPWTLLN
Species Reactivity Human, Mouse
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.