TOMM22 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

TOMM22 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-233133

Product Name TOMM22 Polyclonal Antibody
Application WB;IHC
Application Key Western blotting
Calculated Mw 15kDa
Cellular Location Mitochondrion outer membrane,Single-pass membrane protein
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of human TOMM22 (NP_064628.1).
Isotype IgG
Observed Mw 16kDa
Product Background The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion.
Positive Samples HeLa,HepG2,K-562
Purification Method Affinity purification
Recommended Dilution WB
Sequence MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRA
Species Reactivity Human, Mouse
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.