PRKACG Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

PRKACG Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-233137

Product Name PRKACG Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 40kDa
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRKACG (NP_002723.2).
Isotype IgG
Observed Mw 42kDa
Product Background Cyclic AMP-dependent protein kinase (PKA) consists of two catalytic subunits and a regulatory subunit dimer. This gene encodes the gamma form of its catalytic subunit. The gene is intronless and is thought to be a retrotransposon derived from the gene for the alpha form of the PKA catalytic subunit.
Positive Samples 293T,SKOV3
Purification Method Affinity purification
Recommended Dilution WB
Sequence MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAID
Species Reactivity Human
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.