POSTN Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

POSTN Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-233140

Product Name POSTN Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 80kDa/83kDa/87kDa/90kDa/93kDa
Cellular Location Golgi apparatus,Secreted,extracellular matrix,extracellular space
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 472-751 of human POSTN (NP_001129408.1).
Isotype IgG
Observed Mw Refer to Figures
Product Background This gene encodes a secreted extracellular matrix protein that functions in tissue development and regeneration, including wound healing, and ventricular remodeling following myocardial infarction. The encoded protein binds to integrins to support adhesion and migration of epithelial cells. This protein plays a role in cancer stem cell maintenance and metastasis. Mice lacking this gene exhibit cardiac valve disease, and skeletal and dental defects. Alternative splicing results in multiple transcript variants encoding different isoforms.
Purification Method Affinity purification
Recommended Dilution WB
Sequence CMEKGSKQGRNGAIHIFREIIKPAEKSLHEKLKQDKRFSTFLSLLEAADLKELLTQPGDWTLFVPTNDAFKGMTSEEKEILIRDKNALQNIILYHLTPGVFIGKGFEPGVTNILKTTQGSKIFLKEVNDTLLVNELKSKESDIMTTNGVIHVVDKLLYPADTPVGNDQLLEILNKLIKYIQIKFVRGSTFKEIPVTVYKPIIKKYTKIIDGVPVEITEKETREERIITGPEIKYTRISTGGGETEETLKKLLQEDTPVRKLQANKKVQGSRRRLREGRSQ
Species Reactivity Mouse
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.