SLC47A1 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

SLC47A1 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-233143

Product Name SLC47A1 Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 31kDa/61kDa/63kDa
Cellular Location Cell membrane,Multi-pass membrane protein
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 460-550 of human SLC47A1 (NP_060712.2).
Isotype IgG
Observed Mw 62kDa
Product Background This gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function.
Positive Samples Rat liver
Purification Method Affinity purification
Recommended Dilution WB
Sequence LNWKKACQQAQVHANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRKQLVLRRGLLL
Species Reactivity Human, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.