EFNB1 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

EFNB1 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-233147

Product Name EFNB1 Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 38kDa
Cellular Location Membrane,Single-pass type I membrane protein
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 259-346 of human EFNB1 (NP_004420.1).
Isotype IgG
Observed Mw 38kDa
Product Background The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system.
Positive Samples Mouse brain
Purification Method Affinity purification
Recommended Dilution WB
Sequence TVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Species Reactivity Mouse
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.