ERCC2 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

ERCC2 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-233148

Product Name ERCC2 Polyclonal Antibody
Application WB;IF
Application Key Western blotting
Calculated Mw 46kDa/86kDa
Cellular Location Cytoplasm,Nucleus,cytoskeleton,spindle
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human ERCC2 (NP_001124339.1).
Isotype IgG
Observed Mw 80kDa
Product Background The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Positive Samples HeLa,K-562,293T,MCF7,mouse lung,mouse testis,rat testis
Purification Method Affinity purification
Recommended Dilution WB
Sequence MRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANV
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.