FOXN3 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

FOXN3 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-233591

Product Name FOXN3 Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 51kDa/53kDa
Cellular Location Nucleus
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 269-468 of human FOXN3 (NP_005188.2).
Isotype IgG
Observed Mw 54kDa
Product Background This gene is a member of the forkhead/winged helix transcription factor family. Checkpoints are eukaryotic DNA damage-inducible cell cycle arrests at G1 and G2. Checkpoint suppressor 1 suppresses multiple yeast checkpoint mutations including mec1, rad9, rad53 and dun1 by activating a MEC1-independent checkpoint pathway. Alternative splicing is observed at the locus, resulting in distinct isoforms.
Positive Samples Mouse pancreas
Purification Method Affinity purification
Recommended Dilution WB
Sequence VRPLPITPIGVTAAMRNGITSCRMRTESEPSCGSPVVSGDPKEDHNYSSAKSSNARSTSPTSDSISSSSSSADDHYEFATKGSQEGSEGSEGSFRSHESPSDTEEDDRKHSQKEPKDSLGDSGYASQHKKRQHFAKARKVPSDTLPLKKRRTEKPPESDDEEMKEAAGSLLHLAGIRSCLNNITNRTAKGQKEQKETTKN
Species Reactivity Mouse
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.