CLCA1 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

CLCA1 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-233592

Product Name CLCA1 Polyclonal Antibody
Application WB;IHC;IF
Application Key Western blotting
Calculated Mw 100kDa
Cellular Location Cell membrane,Extracellular side,Peripheral membrane protein,Secreted,extracellular space
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-150 of human CLCA1 (NP_001276.2).
Isotype IgG
Observed Mw 85kDa
Product Background This gene encodes a member of the calcium sensitive chloride conductance protein family. To date, all members of this gene family map to the same region on chromosome 1p31-p22 and share a high degree of homology in size, sequence, and predicted structure, but differ significantly in their tissue distributions. The encoded protein is expressed as a precursor protein that is processed into two cell-surface-associated subunits, although the site at which the precursor is cleaved has not been precisely determined. The encoded protein may be involved in mediating calcium-activated chloride conductance in the intestine.
Positive Samples mouse uterus,rat small intestine
Purification Method Affinity purification
Recommended Dilution WB
Sequence NSLIQLNNNGYEGIVVAIDPNVPEDETLIQQIKDMVTQASLYLFEATGKRFYFKNVAILIPETWKTKADYVRPKLETYKNADVLVAESTPPGNDEPYTEQMGNCGEKGERIHLTPDFIAGKKLAEYGPQ
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.