CHRNA3 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

CHRNA3 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-234636

Product Name CHRNA3 Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 55kDa/57kDa
Cellular Location Cell junction,Cell membrane,Multi-pass membrane protein,postsynaptic cell membrane,synapse
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 32-240 of human CHRNA3 (NP_000734.2).
Isotype IgG
Observed Mw 57kDa
Product Background This locus encodes a member of the nicotinic acetylcholine receptor family of proteins. Members of this family of proteins form pentameric complexes comprised of both alpha and beta subunits. This locus encodes an alpha-type subunit, as it contains characteristic adjacent cysteine residues. The encoded protein is a ligand-gated ion channel that likely plays a role in neurotransmission. Polymorphisms in this gene have been associated with an increased risk of smoking initiation and an increased susceptibility to lung cancer. Alternatively spliced transcript variants have been described.
Positive Samples SH-SY5Y,HepG2,Mouse brain,Rat liver
Purification Method Affinity purification
Recommended Dilution WB
Sequence SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.