SLC30A8 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

SLC30A8 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-234639

Product Name SLC30A8 Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 35kDa/40kDa
Cellular Location Cell membrane,Cytoplasmic vesicle,Multi-pass membrane protein,secretory vesicle membrane
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human SLC30A8 (NP_776250.2).
Isotype IgG
Observed Mw 56kDa
Product Background The protein encoded by this gene is a zinc efflux transporter involved in the accumulation of zinc in intracellular vesicles. This gene is expressed at a high level only in the pancreas, particularly in islets of Langerhans. The encoded protein colocalizes with insulin in the secretory pathway granules of the insulin-secreting INS-1 cells. Allelic variants of this gene exist that confer susceptibility to diabetes mellitus, noninsulin-dependent (NIDDM). Several transcript variants encoding different isoforms have been found for this gene.
Positive Samples A-549,U-87MG,293T,Mouse kidney
Purification Method Affinity purification
Recommended Dilution WB
Sequence MEFLERTYLVNDKAAKMYAFTLESVELQQKPVNKDQCPRERPEELESGGMYHCHSGSKPTEKGANEYAYAKWKLC
Species Reactivity Human, Mouse
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.