HBEGF Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

HBEGF Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-234648

Product Name HBEGF Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 23kDa
Cellular Location Cell membrane,Secreted,Single-pass type I membrane protein,extracellular space
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-160 of human HBEGF (NP_001936.1).
Isotype IgG
Observed Mw 23kDa
Positive Samples U-87MG,Mouse skeletal muscle
Purification Method Affinity purification
Recommended Dilution WB
Sequence LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHT
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.