ELN Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

ELN Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-235209

Product Name ELN Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 48kDa/56-69kDa
Cellular Location Secreted,extracellular matrix,extracellular space
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 27-200 of human ELN (NP_001265845.1).
Isotype IgG
Observed Mw 85kDa
Product Background This gene encodes a protein that is one of the two components of elastic fibers. The encoded protein is rich in hydrophobic amino acids such as glycine and proline, which form mobile hydrophobic regions bounded by crosslinks between lysine residues. Deletions and mutations in this gene are associated with supravalvular aortic stenosis (SVAS) and autosomal dominant cutis laxa. Multiple transcript variants encoding different isoforms have been found for this gene.
Positive Samples A375,293T,HL-60,Mouse heart,Rat heart
Purification Method Affinity purification
Recommended Dilution WB
Sequence GGVPGAIPGGVPGGVFYPGAGLGALGGGALGPGGKPLKPVPGGLAGAGLGAGLGAFPAVTFPGALVPGGVADAAAAYKAAKAGAGLGGVPGVGGLGVSAGAVVPQPGAGVKPGKVPGVGLPGVYPGGVLPGARFPGVGVLPGVPTGAGVKPKAPGVGGAFAGIPGVGPFGGPQP
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.