SLC16A2 Polyclonal Antibody
The product is for non-human research only. Not for therapeutic or veterinary use.
Catalog No: bt-235710
| Product Name | SLC16A2 Polyclonal Antibody |
|---|---|
| Application | WB |
| Application Key | Western blotting |
| Calculated Mw | 59kDa |
| Cellular Location | Cell membrane,Multi-pass membrane protein |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC16A2 (NP_006508.2). |
| Isotype | IgG |
| Observed Mw | 70kDa |
| Product Background | This gene encodes an integral membrane protein that functions as a transporter of thyroid hormone. The encoded protein facilitates the cellular importation of thyroxine (T4), triiodothyronine (T3), reverse triiodothyronine (rT3) and diidothyronine (T2). This gene is expressed in many tissues and likely plays an important role in the development of the central nervous system. Loss of function mutations in this gene are associated with psychomotor retardation in males while females exhibit no neurological defects and more moderate thyroid-deficient phenotypes. This gene is subject to X-chromosome inactivation. Mutations in this gene are the cause of Allan-Herndon-Dudley syndrome. |
| Positive Samples | LO2,HT-29,293T,Mouse heart,Mouse kidney,Mouse liver,Rat heart,Rat liver |
| Purification Method | Affinity purification |
| Recommended Dilution | WB |
| Sequence | MALQSQASEEAKGPWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVPPPEPQPEPQPLPDPAPLPELEFESERVHEPEPTPTVETRGTARGFQPPEGGFG |
| Species Reactivity | Human, Mouse, Rat |
| Storage Buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |