IFIT3 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

IFIT3 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-235858

Product Name IFIT3 Polyclonal Antibody
Application WB;IHC;IF
Application Key Western blotting
Calculated Mw 47kDa
Cellular Location Cytoplasm,Mitochondrion
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 128-331 of mouse IFIT3 (NP_034631.1).
Isotype IgG
Observed Mw 60kDa
Positive Samples Mouse kidney,Rat liver
Purification Method Affinity purification
Recommended Dilution WB
Sequence ANPYSMECPELECEEGWTRLKCGRNERAKMCFEKALEEKPKDPECSSGMAIAMFRLEEKPEKQFSVDALKQAMELNPQNQYLKVLLALKLLRMGEEAEGERLIKDALGKAPNQTDVLQKAAQFYKKKGNLDRAIELLGKALRSTVNNSPLYSLVMCRYREILEQLQNKGDADSSERRQRMAELRRLTMEFMQKTLQRRRSPLNS
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.