PARN Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

PARN Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-235896

Product Name PARN Polyclonal Antibody
Application WB;IHC;IF
Application Key Western blotting
Calculated Mw 52kDa/66kDa/67kDa/73kDa
Cellular Location Cytoplasm,Nucleus,nucleolus
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human PARN (NP_002573.1).
Isotype IgG
Observed Mw 73kDa
Product Background The protein encoded by this gene is a 3'-exoribonuclease, with similarity to the RNase D family of 3'-exonucleases. It prefers poly(A) as the substrate, hence, efficiently degrades poly(A) tails of mRNAs. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs. This protein is also involved in silencing of certain maternal mRNAs during oocyte maturation and early embryonic development, as well as in nonsense-mediated decay (NMD) of mRNAs that contain premature stop codons. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Positive Samples MCF7,HepG2
Purification Method Affinity purification
Recommended Dilution WB
Sequence MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANS
Species Reactivity Human
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.