BCAS2 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

BCAS2 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-236077

Product Name BCAS2 Polyclonal Antibody
Application WB;IHC;IF
Application Key Western blotting
Calculated Mw 26kDa
Cellular Location Nucleus,nucleolus
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-225 of human BCAS2 (NP_005863.1).
Isotype IgG
Observed Mw 25kDa
Positive Samples 293T,Jurkat,MCF-7,HeLa,SKOV3,Mouse testis,Mouse spleen,Mouse lung,Rat lung
Purification Method Affinity purification
Recommended Dilution WB
Sequence MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.