TUBGCP3 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

TUBGCP3 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-236081

Product Name TUBGCP3 Polyclonal Antibody
Application WB;IHC;IF
Application Key Western blotting
Calculated Mw 48kDa/93kDa/103kDa
Cellular Location Cytoplasm,centrosome,cytoskeleton,microtubule organizing center
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human TUBGCP3 (NP_001273207.1).
Isotype IgG
Observed Mw 105kDa
Positive Samples Mouse brain,Mouse spleen,Mouse thymus,Rat testis
Purification Method Affinity purification
Recommended Dilution WB
Sequence MATPDQKSPNVLLQNLCCRILGRSEADVAQQFQYAVRVIGSNFAPTVERDEFLVAEKIKKELIRQRREADAALFSELHRKLHSQGVLKNKWSILYLLLSLSEDPRRQPSKVSSYATLFAQALPRDAHSTPYYYARPQTLPLSYQDRSAQSAQSSGSVGSSGISSIGLCALSGPAPAPQSLLPGQSNQAPGVGDCLRQQLGSRLAWTLTANQPSSQATTSKGVPSAVSRNMTRSRREGDTGGTMEITEAAL
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.