TOMM6 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

TOMM6 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-236446

Product Name TOMM6 Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 8kDa
Cellular Location Mitochondrion outer membrane
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-74 of human TOMM6 (NP_001127965.1).
Isotype IgG
Observed Mw 13kDa
Positive Samples Mouse liver,Mouse kidney
Purification Method Affinity purification
Recommended Dilution WB
Sequence MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQPGV
Species Reactivity Mouse
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.