GRP Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

GRP Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-237176

Product Name GRP Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 15kDa/16kDa
Cellular Location Secreted
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-148 of human GRP (NP_002082.2).
Isotype IgG
Observed Mw 16kDa
Product Background This gene encodes a member of the bombesin-like family of gastrin-releasing peptides. The encoded preproprotein is proteolytically processed to generate two peptides, gastrin-releasing peptide and neuromedin-C. These peptides regulate numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation. These peptides are also likely to play a role in human cancers of the lung, colon, stomach, pancreas, breast, and prostate. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed.
Positive Samples Mouse lung,Mouse spinal cord,Rat brain,Rat kidney
Purification Method Affinity purification
Recommended Dilution WB
Sequence MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.