PCBD1 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

PCBD1 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-237186

Product Name PCBD1 Polyclonal Antibody
Application WB;IF
Application Key Western blotting
Calculated Mw 12kDa
Cellular Location Cytoplasm,Nucleus
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-104 of human PCBD1 (NP_000272.1).
Isotype IgG
Observed Mw 12kDa
Product Background This gene encodes a member of the pterin-4-alpha-carbinolamine dehydratase family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. The encoded protein functions as both a dehydratase involved in tetrahydrobiopterin biosynthesis, and as a cofactor for HNF1A-dependent transcription. A deficiency of this enzyme leads to hyperphenylalaninemia. Alternative splicing results in multiple transcript variants.
Positive Samples SW620,Mouse liver,Mouse kidney,Mouse pancreas,Rat liver
Purification Method Affinity purification
Recommended Dilution WB
Sequence MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.