PNLIP Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

PNLIP Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-237190

Product Name PNLIP Polyclonal Antibody
Application WB;IHC;IF
Application Key Western blotting
Calculated Mw 51kDa
Cellular Location Secreted
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 166-465 of human PNLIP (NP_000927.1).
Isotype IgG
Observed Mw 55kDa
Product Background This gene is a member of the lipase gene family. It encodes a carboxyl esterase that hydrolyzes insoluble, emulsified triglycerides, and is essential for the efficient digestion of dietary fats. This gene is expressed specifically in the pancreas.
Positive Samples Mouse liver,Mouse pancreas
Purification Method Affinity purification
Recommended Dilution WB
Sequence IGHSLGAHAAGEAGRRTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGHLDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGFPCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWYNNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.