KLK10 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

KLK10 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-237192

Product Name KLK10 Polyclonal Antibody
Application WB;IHC;IF
Application Key Western blotting
Calculated Mw 30kDa
Cellular Location Secreted
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 35-276 of human KLK10 (NP_001070968.1).
Isotype IgG
Observed Mw 30kDa
Product Background Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its encoded protein is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers. Alternate splicing of this gene results in multiple transcript variants encoding the same protein.
Positive Samples Mouse liver,Mouse brain,Mouse heart,Rat liver
Purification Method Affinity purification
Recommended Dilution WB
Sequence LLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.