ASAH1 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

ASAH1 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-237296

Product Name ASAH1 Polyclonal Antibody
Application WB
Application Key Western blotting
Calculated Mw 44kDa/46kDa
Cellular Location Lysosome
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 140-389 of human ASAH1 (NP_001120977.1).
Isotype IgG
Observed Mw 50kDa
Product Background This gene encodes a member of the acid ceramidase family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. Processing of this preproprotein generates alpha and beta subunits that heterodimerize to form the mature lysosomal enzyme, which catalyzes the degradation of ceramide into sphingosine and free fatty acid. This enzyme is overexpressed in multiple human cancers and may play a role in cancer progression. Mutations in this gene are associated with the lysosomal storage disorder, Farber lipogranulomatosis, and a neuromuscular disorder, spinal muscular atrophy with progressive myoclonic epilepsy.
Positive Samples Mouse kidney,Mouse heart,Rat heart
Purification Method Affinity purification
Recommended Dilution WB
Sequence IVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSINGGYLGILEWILGKKDVMWIGFLTRTVLENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQFETYLRDCPDPCIGW
Species Reactivity Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.