CACNG2 Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

CACNG2 Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-237299

Product Name CACNG2 Polyclonal Antibody
Application WB;IF
Application Key Western blotting
Calculated Mw 35kDa
Cellular Location Membrane,Multi-pass membrane protein
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 204-323 of human CACNG2 (NP_006069.1).
Isotype IgG
Observed Mw 36kDa
Product Background The protein encoded by this gene is a type I transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family. This gene is a susceptibility locus for schizophrenia.
Positive Samples Mouse brain,Rat brain
Purification Method Affinity purification
Recommended Dilution WB
Sequence RHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSSSRSTEPSHSRDASPVGIKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVHNCIQKENKDSLHSNTANRRTTPV
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.