CCNC Polyclonal Antibody Antibodies
$ $99 In stock
Formulation:
Source:
Usage:

CCNC Polyclonal Antibody

The product is for non-human research only. Not for therapeutic or veterinary use.

Catalog No: bt-237304

Product Name CCNC Polyclonal Antibody
Application WB;IHC;IF
Application Key Western blotting
Calculated Mw 22kDa/33kDa
Cellular Location Nucleus
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-283 of human CCNC (NP_005181.2).
Isotype IgG
Observed Mw 26-33kDa
Product Background The protein encoded by this gene is a member of the cyclin family of proteins. The encoded protein interacts with cyclin-dependent kinase 8 and induces the phophorylation of the carboxy-terminal domain of the large subunit of RNA polymerase II. The level of mRNAs for this gene peaks in the G1 phase of the cell cycle. Two transcript variants encoding different isoforms have been found for this gene.
Positive Samples MCF7,NIH/3T3,Mouse liver,Mouse kidney,Rat liver
Purification Method Affinity purification
Recommended Dilution WB
Sequence MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS
Species Reactivity Human, Mouse, Rat
Storage Buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.